PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do000437.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 187aa    MW: 18733.5 Da    PI: 8.1184
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do000437.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof99.62e-314084347
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalr 47
                 +al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lr
  Do000437.1 40 AEALRCPRCDSANTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLR 84
                57899***************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-223784IPR003851Zinc finger, Dof-type
PfamPF027015.5E-284285IPR003851Zinc finger, Dof-type
PROSITE profilePS5088422.8534397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MAGAGGATAV QQPAAAGASG GARSGAGAGA AGAPVADPRA EALRCPRCDS ANTKFCYYNN  60
YSLSQPRHFC KACKRYWTRG GTLRXELHVK AEAGGAGDHQ QKAAPGEQQS GSWELPTPSS  120
SNVDANIIAS DALMAAAASM NPAVSSTSTA AITAPSSFMY WGNGGIGGAA AAWPDLTNCG  180
SSIATLF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824031e-118KC582403.1 Sorghum bicolor dof6 protein (dof6) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957815.15e-37PREDICTED: dof zinc finger protein DOF5.1-like
TrEMBLA0A0A9J3V13e-42A0A0A9J3V1_ARUDO; Uncharacterized protein
STRINGGRMZM2G064655_P015e-35(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88953041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.21e-25Dof family protein